Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Elongation factor P (efp)

Product Specifications

Product Name Alternative

Short name:EF-P

Abbreviation

Recombinant E.coli efp protein

Gene Name

Efp

UniProt

B1XDQ0

Expression Region

1-188aa

Organism

Escherichia coli (strain K12 / DH10B)

Target Sequence

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Relevance

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Molecular Weight

22.6 kDa

References & Citations

"The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse."Durfee T., Nelson R., Baldwin S., Plunkett G. III, Burland V., Mau B., Petrosino J.F., Qin X., Muzny D.M., Ayele M., Gibbs R.A., Csorgo B., Posfai G., Weinstock G.M., Blattner F.R.J. Bacteriol. 190:2597-2606 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SerpinB9g Double Nickase Plasmid (m2)
sc-430052-NIC-2 20 µg

SerpinB9g Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
2-Aminopurine Riboside
sc-220703E 1 g

2-Aminopurine Riboside

Sign In for Pricing
View Details
Olr1022 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7404604 1.0 µg DNA

Olr1022 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
6-Pyridin-2-yl-1H-indazole
sc-291415 250 mg

6-Pyridin-2-yl-1H-indazole

Sign In for Pricing
View Details
Mouse Flavin Containing Monooxygenase ELISA Kit
MBS3807095-01 48 Well

Mouse Flavin Containing Monooxygenase ELISA Kit

Sign In for Pricing
View Details
Mouse Flavin Containing Monooxygenase ELISA Kit
MBS3807095-02 96 Well

Mouse Flavin Containing Monooxygenase ELISA Kit

Sign In for Pricing
View Details