Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA)

Product Specifications

Product Name Alternative

LolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein

Abbreviation

Recombinant E.coli O9:H4 lolA protein

Gene Name

LolA

UniProt

A7ZYJ5

Expression Region

22-203aa

Organism

Escherichia coli O9:H4 (strain HS)

Target Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Participates in the translocation of lipoproteins from the inner mbrane to the outer mbrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner mbrane) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane) .

Molecular Weight

22.3 kDa

References & Citations

The pangenome structure of Escherichia coli comparative genomic analysis of E. coli commensal and pathogenic isolates.Rasko D.A., Rosovitz M.J., Myers G.S.A., Mongodin E.F., Fricke W.F., Gajer P., Crabtree J., Sebaihia M., Thomson N.R., Chaudhuri R., Henderson I.R., Sperandio V., Ravel J.J. Bacteriol. 190:6881-6893 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN2 (NM_001278344) Human Untagged Clone
SC337196 10 µg

ACTN2 (NM_001278344) Human Untagged Clone

Sign In for Pricing
View Details
NR2B (APC) discontinued
N5380-30-APC 100 µL

NR2B (APC) discontinued

Sign In for Pricing
View Details
Mouse IgG2a (Fc Silent) Isotpye Control (MOPC 173), FITC
RMB96792 100 Tests

Mouse IgG2a (Fc Silent) Isotpye Control (MOPC 173), FITC

Sign In for Pricing
View Details
Recombinant Brucella Abortus acpP Protein (strain S19) (aa 1-78)
VAng-Lsx4945-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus acpP Protein (strain S19) (aa 1-78)

Sign In for Pricing
View Details
Gls ORF Vector (Rat) (pORF)
ORF067611 1.0 µg DNA

Gls ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Slc11a2 3'UTR Lenti-reporter-Luc Vector
43869084 1.0 µg

Slc11a2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details