Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC)

Product Specifications

Product Name Alternative

LptC; c3959; Lipopolysaccharide export system protein LptC

Abbreviation

Recombinant E.coli O6:H1 lptC protein

Gene Name

LptC

UniProt

P0ADW0

Expression Region

1-191aa

Organism

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Target Sequence

MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the assbly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA.

Molecular Weight

37.7 kDa

References & Citations

Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli.Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytochrome P450 3A4 Antibody (P6) [DyLight 550]
NBP2-50207R 0.1 mL

Mouse Monoclonal Cytochrome P450 3A4 Antibody (P6) [DyLight 550]

Sign In for Pricing
View Details
anti-CD96
YF-PA16805 50 ug

anti-CD96

Sign In for Pricing
View Details
RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405)
MBS6497079-01 0.1 mL

RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405)

Sign In for Pricing
View Details
RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405)
MBS6497079-02 5x 0.1 mL

RCC1-like G Exchanging Factor, NT (RCC1 And BTB Domain-containing Protein 2, Regulator Of Chromosome Condensation And BTB Domain-containing Protein 2, Chromosome Condensation 1-like, CHC1-L, CHC1L, RLG, RCBTB2) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 PSIE Polyclonal Antibody
MBS9004460 Inquire

Rabbit anti-Escherichia coli O157:H7 PSIE Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) UVRA Polyclonal Antibody
MBS7164953 Inquire

Rabbit anti-Escherichia coli (strain K12) UVRA Polyclonal Antibody

Sign In for Pricing
View Details