Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli CS6 fimbrial subunit B (cssB)

Product Specifications

Product Name Alternative

CssBCS6 fimbrial subunit B

Abbreviation

Recombinant E.coli cssB protein

Gene Name

CssB

UniProt

P53510

Expression Region

22-167aa

Organism

Escherichia coli

Target Sequence

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.9 kDa

References & Citations

"Crystal structure of enterotoxigenic Escherichia coli colonization factor CS6 reveals a novel type of functional assembly."Roy S.P., Rahman M.M., Yu X.D., Tuittila M., Knight S.D., Zavialov A.V.Mol. Microbiol. 86:1100-1115 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF568 conjugate, 0.1mg/mL
BNC683462-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (rC31.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1087-01 50 μL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1087-02 100 µL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1087-03 1 mL

DNAJB6 Antibody

Sign In for Pricing
View Details
EPOR (NM_000121) Human Over-expression Lysate
LC424912 20 µg

EPOR (NM_000121) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565689 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details