Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Histone deacetylase HDT2 (HDT2)

Product Specifications

Product Name Alternative

HD-tuins protein 2 Histone deacetylase 2b

Abbreviation

Recombinant Mouse-ear cress HDT2 protein

Gene Name

HDT2

UniProt

Q56WH4

Expression Region

1-306aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) . Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.

Molecular Weight

34.3 kDa

References & Citations

"Functional analysis of HD2 histone deacetylase homologues in Arabidopsis thaliana."Wu K., Tian L., Malik K., Brown D., Miki B.Plant J. 22:19-27 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa subsp. japonica (Rice) PL10A Polyclonal Antibody
MBS7198786 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) PL10A Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae VAM7 Protein (aa 1-316) [His]
VAng-Wyb6170-1mg 1 mg

Recombinant Saccharomyces Cerevisiae VAM7 Protein (aa 1-316) [His]

Sign In for Pricing
View Details
CDC37L1 Protein Vector (Human) (pPM-C-His)
PV008676 500 ng

CDC37L1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CDC23 Antibody
A16708-100UL 100 µL

CDC23 Antibody

Sign In for Pricing
View Details
Rat Monoclonal CRACC/SLAMF7 Antibody (520914) [Biotin]
FAB46281B 0.1 mL

Rat Monoclonal CRACC/SLAMF7 Antibody (520914) [Biotin]

Sign In for Pricing
View Details
Anti-Hu CD147 Purified
MBS1801327-01 0.1 mg

Anti-Hu CD147 Purified

Sign In for Pricing
View Details