Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

Amyloid fibril protein AA

Abbreviation

Recombinant Horse SAA1 protein

Gene Name

SAA1

UniProt

P19857

Expression Region

1-110aa

Organism

Equus caballus (Horse)

Target Sequence

LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Molecular Weight

14.3 kDa

References & Citations

The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RC (Biotin)
C2400-91D-Biotin 100 µL

CD45RC (Biotin)

Sign In for Pricing
View Details
CBWD1 (NM_001145356) Human Tagged ORF Clone Lentiviral Particle
RC227294L4V 200 µL

CBWD1 (NM_001145356) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ENO1 Protein (N-His, Human)
P503609 100 µg

ENO1 Protein (N-His, Human)

Sign In for Pricing
View Details
Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit
MBS9319354-01 48 Well

Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit

Sign In for Pricing
View Details
Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit
MBS9319354-02 96 Well

Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit

Sign In for Pricing
View Details
Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit
MBS9319354-03 5x 96 Well

Bovine Endothelial cell-specific chemotaxis regulator, ECSCR ELISA Kit

Sign In for Pricing
View Details