Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Serum amyloid A protein (SAA1)

Product Specifications

Product Name Alternative

Amyloid fibril protein AA

Abbreviation

Recombinant Horse SAA1 protein

Gene Name

SAA1

UniProt

P19857

Expression Region

1-110aa

Organism

Equus caballus (Horse)

Target Sequence

LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Major acute phase reactant. Apolipoprotein of the HDL complex.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Molecular Weight

14.3 kDa

References & Citations

The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD13A Protein Vector (Rat) (pPB-C-His)
PV253610 500 ng

ANKRD13A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Mouse CXC-chemokine ligand 15 (CXCL15) ELISA Kit
YP-W21663-01 48 Tests

Mouse CXC-chemokine ligand 15 (CXCL15) ELISA Kit

Sign In for Pricing
View Details
Mouse CXC-chemokine ligand 15 (CXCL15) ELISA Kit
YP-W21663-02 96 Tests

Mouse CXC-chemokine ligand 15 (CXCL15) ELISA Kit

Sign In for Pricing
View Details
5-Bromo-2-chlorothien-3-yl Tioconazole Hydrochloride
TRC-B682560-250MG 250 mg

5-Bromo-2-chlorothien-3-yl Tioconazole Hydrochloride

Sign In for Pricing
View Details
PAR4 (Proteinase Activated Receptor 4, PAR-4, Coagulation Factor II Receptor-like 3, F2RL3, Thrombin Receptor-like 3) (FITC)
130870-FITC 100 µL

PAR4 (Proteinase Activated Receptor 4, PAR-4, Coagulation Factor II Receptor-like 3, F2RL3, Thrombin Receptor-like 3) (FITC)

Sign In for Pricing
View Details
Ptp4a1 ORF Vector (Mouse) (pORF)
ORF055198 1.0 µg DNA

Ptp4a1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details