Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OX40/TNFRSF4, Mouse (HEK293, His)

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Mouse (HEK293, His) is a recombinant mouse OX40 (V20-P211) with C-terminal 6*His tag, which is produced in HEK293.

Product Specifications

Product Name Alternative

OX40/TNFRSF4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ox40-tnfrsf4-protein-mouse-hek293-his.html

Purity

95.0

Smiles

VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

Molecular Formula

22163 (Gene_ID) P47741 (V20-P211) (Accession)

Molecular Weight

Approximately 38.42 kDa

References & Citations

[1]Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141 (2) :494-499.|[2]Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637.|[3]Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117 (10) :2910-7.|[4]Arestides RS, et al. Costimulatory molecule OX40L is critical for both Th1 and Th2 responses in allergic inflammation. Eur J Immunol. 2002 Oct;32 (10) :2874-80. |[5]Kotani A, et al. Signaling of gp34 (OX40 ligand) induces vascular endothelial cells to produce a CC chemokine RANTES/CCL5. Immunol Lett. 2002 Oct 21;84 (1) :1-7. |[6]Wu LY, et al. Recombinant OX40 attenuates neuronal apoptosis through OX40-OX40L/PI3K/AKT signaling pathway following subarachnoid hemorrhage in rats. Exp Neurol. 2020 Apr;326:113179.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (MaxLight 650)
MBS6229147-01 0.1 mL

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (MaxLight 650)

Sign In for Pricing
View Details
PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (MaxLight 650)
MBS6229147-02 5x 0.1 mL

PBK (PDZ Binding Kinase, FLJ14385, Nori-3, SPK, TOPK) (MaxLight 650)

Sign In for Pricing
View Details
PE-conjugated Anti-GFAP (68-377) antibody (21H9), Rabbit mAb
MBS1882787-01 100 Tests

PE-conjugated Anti-GFAP (68-377) antibody (21H9), Rabbit mAb

Sign In for Pricing
View Details
PE-conjugated Anti-GFAP (68-377) antibody (21H9), Rabbit mAb
MBS1882787-02 5x 100 Tests

PE-conjugated Anti-GFAP (68-377) antibody (21H9), Rabbit mAb

Sign In for Pricing
View Details
DiagSupport™ Ethyl Sulfonic Acid Polystyrene Resin, 100-200 Mesh, 0.5-1.5 mmol/g
SPS-RA23-160 1 g

DiagSupport™ Ethyl Sulfonic Acid Polystyrene Resin, 100-200 Mesh, 0.5-1.5 mmol/g

Sign In for Pricing
View Details
C4orf42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV810616 1.0 µg DNA

C4orf42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details