CD40, Human (HEK293, Fc)
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, Fc) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD40 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd40-protein-human-hek293-his-fc.html
Purity
98.0
Smiles
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Molecular Formula
958 (Gene_ID) P25942-1 (E21-R193) (Accession)
Molecular Weight
Approximately 54.1 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400043-100 1x 100 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400043-500 1x 500 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470759-100 1x 100 µL
Human IgM Immunoglobulin (DA4-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details