Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Human (HEK293, Fc)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6) . CD40 Protein, Human (HEK293, Fc) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-human-hek293-his-fc.html

Purity

98.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Formula

958 (Gene_ID) P25942-1 (E21-R193) (Accession)

Molecular Weight

Approximately 54.1 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

InVivoMAb Anti-HIV2 gp125 Antibody (7C8)
MBS1579906-01 0.1 mg

InVivoMAb Anti-HIV2 gp125 Antibody (7C8)

Sign In for Pricing
View Details
InVivoMAb Anti-HIV2 gp125 Antibody (7C8)
MBS1579906-02 1 mg

InVivoMAb Anti-HIV2 gp125 Antibody (7C8)

Sign In for Pricing
View Details
InVivoMAb Anti-HIV2 gp125 Antibody (7C8)
MBS1579906-03 5x 1 mg

InVivoMAb Anti-HIV2 gp125 Antibody (7C8)

Sign In for Pricing
View Details
Tcp11l1 (NM_177190) Mouse Tagged Lenti ORF Clone
MR223161L3 10 µg

Tcp11l1 (NM_177190) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Duck Elongation of Very Long Chain Fatty Acids Protein 3 (ELOVL3) ELISA Kit
MBS9392520 Inquire

Duck Elongation of Very Long Chain Fatty Acids Protein 3 (ELOVL3) ELISA Kit

Sign In for Pricing
View Details
HENMT1 Rabbit Polyclonal Antibody
orb1939997 100 µg

HENMT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details