Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ephrin-B3 (Efnb3), partial

Product Specifications

Product Name Alternative

Efnb3Ephrin-B3

Abbreviation

Recombinant Mouse Efnb3 protein, partial

Gene Name

Efnb3

UniProt

O35393

Expression Region

28-227aa

Organism

Mus musculus (Mouse)

Target Sequence

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Cell surface transmbrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

Molecular Weight

24 kDa

References & Citations

Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.Bergemann A.D., Zhang L., Chiang M.-K., Brambilla R., Klein R., Flanagan J.G.Oncogene 16:471-480 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ATP5I Antibody
NBP1-89496 0.1 mL

Rabbit Polyclonal ATP5I Antibody

Ask
View Details
Cynomolgus TSPAN7 Protein, Fc Tag
PM294 20 µg

Cynomolgus TSPAN7 Protein, Fc Tag

Ask
View Details
Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)
MBS2096704-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)
MBS2096704-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)
MBS2096704-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)

Ask
View Details
Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)
MBS2096704-04 1 mL

Biotin-Linked Polyclonal Antibody to Carnosine Synthase 1 (CARNS1)

Ask
View Details