Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant mouse Interleukin-2 receptor subunit beta (Il2rb), partial

Product Specifications

Product Name Alternative

High affinity IL-2 receptor subunit betap70-75; CD122

Abbreviation

Recombinant Mouse Il2rb protein, partial

Gene Name

Il2rb

UniProt

P16297

Expression Region

27-240aa

Organism

Mus musculus (Mouse)

Target Sequence

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Molecular Weight

27.1 kDa

References & Citations

Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 830 succinimidyl ester
71400-AAT 100 µg

IFluor® 830 succinimidyl ester

Sign In for Pricing
View Details
5-(N-tert-Butoxycarbonylamino)salicylic Acid
TRC-B690280-500MG 500 mg

5-(N-tert-Butoxycarbonylamino)salicylic Acid

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), 0.2mg/mL
BNUB2563-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), 0.2mg/mL

Sign In for Pricing
View Details
JNK3 Recombinant Rabbit Monoclonal Antibody [SD082-09]
ET1612-68 100 µL

JNK3 Recombinant Rabbit Monoclonal Antibody [SD082-09]

Sign In for Pricing
View Details
CALmL4 (NM_001031733) Human Over-expression Lysate
LC422179 20 µg

CALmL4 (NM_001031733) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX9 Rabbit Polyclonal Antibody
TA371249 100 µL

SOX9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details