Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Membrane cofactor protein (CD46), partial

Product Specifications

Product Name Alternative

CD_antigen: CD46

Abbreviation

Recombinant Guinea pig CD46 protein, partial

Gene Name

CD46

UniProt

P70105

Expression Region

36-316aa

Organism

Cavia porcellus (Guinea pig)

Target Sequence

CVLPPPFEAMEPINPKPYYEIGEKVEYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWGDIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQVFEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQISGLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNYPGYPNPREGIFDQELN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Molecular Weight

35.4 kDa

References & Citations

"Molecular cloning of guinea pig membrane cofactor protein: preferential expression in testis."Hosokawa M., Nonaka M., Okada N., Nonaka M., Okada H.J. Immunol. 157:4946-4952 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST Rabbit Polyclonal Antibody
1003-8 100 µL

GST Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HTA2 Rabbit Monoclonal Antibody
TA422485 100 µL

HTA2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rbm17 Mouse Gene Knockout Kit (CRISPR)
KN514553 1 Kit

Rbm17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C-Myc (MYC909), CF568 conjugate, 0.1mg/mL
BNC680909-100 1x 100 µL

C-Myc (MYC909), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS642515 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Uncoated Mouse EGFR (Epidermal Growth Factor Receptor) ELISA Kit
E-UNEL-M0039-01 5x 96 Tests

Uncoated Mouse EGFR (Epidermal Growth Factor Receptor) ELISA Kit

Sign In for Pricing
View Details