Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Autolysin (lytA)

Product Specifications

Product Name Alternative

N-acetylmuramoyl-L-alanine amidase

Abbreviation

Recombinant Staphylococcus aureus lytA protein

Gene Name

LytA

UniProt

P24556

Expression Region

1-481aa

Organism

Staphylococcus aureus

Target Sequence

MQAKLTKNEFIERLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPAGVGKKLQDDNMLMISLCGLSVRILKVRQRHDQFNLLHKHPKKETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTVWQALDESQVGWHTANQIGNKYYYGIEVCQSMGADNATFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMDGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQRYYLPIRTWNGSAPPNQILGDLWGEIS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Autolysins are involved in some important biological processes such as cell separation, cell-wall turnover, competence for genetic transformation, formation of the flagella and sporulation. Autolysin strictly depends on the presence of choline-containing cell walls for activity.

Molecular Weight

57.8 kDa

References & Citations

"Sequence analysis of a Staphylococcus aureus gene encoding a peptidoglycan hydrolase activity." Wang X., Wilkinson B.J., Jayaswal R.K. Gene 102:105-109 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0016140-01 20 µL

Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0016140-02 100 µL

Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0016140-03 200 µL

Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
TRV-0016140-04 1 mL

Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)

Sign In for Pricing
View Details
HSD17B4/MPF-2 Antibody
3627-100 100 µg

HSD17B4/MPF-2 Antibody

Sign In for Pricing
View Details
Apolipoprotein D (APOD) Human Over-expression Lysate
orb1344620 100 µg

Apolipoprotein D (APOD) Human Over-expression Lysate

Sign In for Pricing
View Details