Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein L (gL)

Product Specifications

Product Name Alternative

GL; UL115Envelope glycoprotein L; gL

Abbreviation

Recombinant Human cytomegalovirus gL protein

Gene Name

GL

UniProt

F5HCH8

Expression Region

31-278aa

Organism

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Target Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.

Molecular Weight

29.5 kDa

References & Citations

Genetic content of wild-type human cytomegalovirus.Dolan A., Cunningham C., Hector R.D., Hassan-Walker A.F., Lee L., Addison C., Dargan D.J., McGeoch D.J., Gatherer D., Emery V.C., Griffiths P.D., Sinzger C., McSharry B.P., Wilkinson G.W.G., Davison A.J.J. Gen. Virol. 85:1301-1312 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL22P19-set siRNA/shRNA/RNAi Lentivector (Human)
41119091 4x 500 ng

RPL22P19-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Heat Shock Protein 27 (HSP27) Antibody (FITC)
abx444911-01 50 µg

Heat Shock Protein 27 (HSP27) Antibody (FITC)

Sign In for Pricing
View Details
Heat Shock Protein 27 (HSP27) Antibody (FITC)
abx444911-02 200 µg

Heat Shock Protein 27 (HSP27) Antibody (FITC)

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Recombinant, Human
156845-01 10 µg

Slit Homolog 2 (Slit2) Recombinant, Human

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Recombinant, Human
156845-02 50 µg

Slit Homolog 2 (Slit2) Recombinant, Human

Sign In for Pricing
View Details
Slit Homolog 2 (Slit2) Recombinant, Human
156845-03 200 µg

Slit Homolog 2 (Slit2) Recombinant, Human

Sign In for Pricing
View Details