Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into: P1; Capsid protein VP0; VP4-VP2) ; Capsid protein VP4; P1A; Virion protein 4) ; Capsid protein VP2; P1B; Virion protein 2) ; Capsid protein VP3; P1C; Virion protein 3) ; Capsid protein VP1; P1D; Virion protein 1) ; P2; Protease 2A; P2A; EC 3.4.22.29; Picornain 2A; Protein 2A) ; Protein 2B; P2B) ; Protein 2C; P2C; EC 3.6.1.15) ; P3; Protein 3AB; Protein 3A; P3A) ; Viral protein genome-linked; VPg; Protein 3B; P3B) ; Protein 3CD; EC 3.4.22.28) ; Protease 3C; EC 3.4.22.28; Picornain 3C; P3C) ; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48; 3D polymerase; 3Dpol; Protein 3D; 3D) ]

Abbreviation

Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial

UniProt

P07210

Expression Region

575-866aa

Organism

Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89)

Target Sequence

NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid protein VP1: Forms an icosahedral capsid of pseudo T=3 symmetry with capsid proteins VP2 and VP3. The capsid is 300 Angstroms in diameter, composed of 60 copies of each capsid protein and enclosing the viral positive strand RNA genome. Capsid protein VP1 mainly forms the vertices of the capsid. Capsid protein VP1 interacts with host cell receptor to provide virion attachment to target host cells. This attachment induces virion internalization. Tyrosine kinases are probably involved in the entry process. After binding to its receptor, the capsid undergoes conformational changes. Capsid protein VP1 N-terminus (that contains an amphipathic alpha-helix) and capsid protein VP4 are externalized. Together, they shape a pore in the host membrane through which viral genome is translocated to host cell cytoplasm. After genome has been released, the channel shrinks

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Capsid protein VP1

Molecular Weight

38.1 kDa

References & Citations

"Evolutionary relationships within the human rhinovirus genus: comparison of serotypes 89, 2, and 14." Duechler M., Skern T., Sommergruber W., Neubauer C., Gruendler P., Fogy I., Blaas D., Kuechler E. Proc. Natl. Acad. Sci. U.S.A. 84:2605-2609 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Branched chain aminotransferase 2, mitochondrial
308180 100 µL

Branched chain aminotransferase 2, mitochondrial

Ask
View Details
Mouse S100 Calcium Binding Protein A11 ELISA Kit
MBS007510-01 48 Well

Mouse S100 Calcium Binding Protein A11 ELISA Kit

Ask
View Details
Mouse S100 Calcium Binding Protein A11 ELISA Kit
MBS007510-02 96 Well

Mouse S100 Calcium Binding Protein A11 ELISA Kit

Ask
View Details
Mouse S100 Calcium Binding Protein A11 ELISA Kit
MBS007510-03 5x 96 Well

Mouse S100 Calcium Binding Protein A11 ELISA Kit

Ask
View Details
Mouse S100 Calcium Binding Protein A11 ELISA Kit
MBS007510-04 10x 96 Well

Mouse S100 Calcium Binding Protein A11 ELISA Kit

Ask
View Details
DAP12 Blocking Peptide
33R-11048 50 ug

DAP12 Blocking Peptide

Ask
View Details