Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial

Product Specifications

Product Name Alternative

Env polyprotein

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype B env protein, partial

Gene Name

Env

UniProt

P04578

Expression Region

33-511aa

Organism

Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

Target Sequence

KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Envelope glycoprotein gp160: Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Envelope glycoprotein gp160

Molecular Weight

69.7 kDa

References & Citations

HIV enters cells via endocytosis and dynamin-dependent fusion with endosomes.Miyauchi K., Kim Y., Latinovic O., Morozov V., Melikyan G.B.Cell 137:433-444 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WSB2 Antibody
A1896-100 100 µL

Anti-WSB2 Antibody

Sign In for Pricing
View Details
Probable serine carboxypeptidase CPVL (CPVL) Human ELISA Kit
G1407 96 Tests

Probable serine carboxypeptidase CPVL (CPVL) Human ELISA Kit

Sign In for Pricing
View Details
SPINK5, NT (Serine Protease Inhibitor Kazal-type 5, Lympho-epithelial Kazal-type-related Inhibitor, LEKTI, Hemofiltrate Peptide HF6478, Hemofiltrate Peptide HF7665) (MaxLight 650) discontinued
S5510-35-ML650 100 µL

SPINK5, NT (Serine Protease Inhibitor Kazal-type 5, Lympho-epithelial Kazal-type-related Inhibitor, LEKTI, Hemofiltrate Peptide HF6478, Hemofiltrate Peptide HF7665) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Slc2a8 shRNA (UAS) - Lentiviral mouse Slc2a8 shRNA (UAS, GFP) plasmid
GTR15297097 1 Vial

Lentiviral mouse Slc2a8 shRNA (UAS) - Lentiviral mouse Slc2a8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Gonadorelin acetate EP Impurity G
RM-G640005-01 10 mg

Gonadorelin acetate EP Impurity G

Sign In for Pricing
View Details
Gonadorelin acetate EP Impurity G
RM-G640005-02 100 mg

Gonadorelin acetate EP Impurity G

Sign In for Pricing
View Details