Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27)

Product Specifications

Product Name Alternative

Phosphoprotein P41 ; PP41; Polymerase accessory protein ; PAP

Abbreviation

Recombinant Human herpesvirus 6A DNA polymerase processivity factor protein

Gene Name

U27

UniProt

P52439

Expression Region

1-393aa

Organism

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Target Sequence

MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Molecular Weight

46.8 kDa

References & Citations

Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Senp3 3'UTR GFP Stable Cell Line
TU270119 1.0 mL

Senp3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Fam166a ORF Vector (Rat) (pORF)
ORF066826 1.0 µg DNA

Fam166a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Rabbit anti-Androctonus australis (Sahara scorpion) Alpha-mammal toxin AaH2 Polyclonal Antibody
MBS7161862 Inquire

Rabbit anti-Androctonus australis (Sahara scorpion) Alpha-mammal toxin AaH2 Polyclonal Antibody

Sign In for Pricing
View Details
2HX-1000-2-BK-4 AB Labels
117590 Roll of 1000 Label(s)

2HX-1000-2-BK-4 AB Labels

Sign In for Pricing
View Details
WISP1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6321R-BF750-TR 20 µL

WISP1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Human Cadherin, Retinal (RCAD) ELISA Kit
MBS9311311-01 48 Well

Human Cadherin, Retinal (RCAD) ELISA Kit

Sign In for Pricing
View Details