Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27)

Product Specifications

Product Name Alternative

Phosphoprotein P41 ; PP41; Polymerase accessory protein ; PAP

Abbreviation

Recombinant Human herpesvirus 6A DNA polymerase processivity factor protein

Gene Name

U27

UniProt

P52439

Expression Region

1-393aa

Organism

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Target Sequence

MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Molecular Weight

46.8 kDa

References & Citations

Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP7 (aa120-131) Antibody
orb385477 100 µg

BMP7 (aa120-131) Antibody

Sign In for Pricing
View Details
Lentiviral human DCAF12L1 shRNA (UAS) - Lentiviral human DCAF12L1 shRNA (UAS, RFP) (100)
GTR15331503 1 Vial

Lentiviral human DCAF12L1 shRNA (UAS) - Lentiviral human DCAF12L1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HCV NS5a Polyclonal Antibody
bs-4856R-TR 20 µL

HCV NS5a Polyclonal Antibody

Sign In for Pricing
View Details
IGF1R Biosimilar Antibody
orb3182615-01 100 µg

IGF1R Biosimilar Antibody

Sign In for Pricing
View Details
IGF1R Biosimilar Antibody
orb3182615-02 500 µg

IGF1R Biosimilar Antibody

Sign In for Pricing
View Details
IGF1R Biosimilar Antibody
orb3182615-03 1 mg

IGF1R Biosimilar Antibody

Sign In for Pricing
View Details