Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Titin (TTN), partial

Product Specifications

Product Name Alternative

Connectin Rhabdomyosarcoma antigen MU-RMS-40.14

Abbreviation

Recombinant Human TTN protein, partial

Gene Name

TTN

UniProt

Q8WZ42

Expression Region

14257-14543aa

Organism

Homo sapiens (Human)

Target Sequence

RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.

Molecular Weight

36.9 kDa

References & Citations

"Series of exon-skipping events in the elastic spring region of titin as the structural basis for myofibrillar elastic diversity." Freiburg A., Trombitas K., Hell W., Cazorla O., Fougerousse F., Centner T., Kolmerer B., Witt C., Beckmann J.S., Gregorio C.C., Granzier H., Labeit S. Circ. Res. 86:1114-1121 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REST Antibody
DF7826-01 100 µL

REST Antibody

Sign In for Pricing
View Details
REST Antibody
DF7826-02 200 µL

REST Antibody

Sign In for Pricing
View Details
Fam184a ORF Vector (Mouse) (pORF)
ORF044406 1.0 µg DNA

Fam184a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)
MBS1214990-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)
MBS1214990-02 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)
MBS1214990-03 0.02 mg (Yeast)

Recombinant Helicobacter pylori Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details