Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein

Abbreviation

Recombinant Human LY6G6D protein, partial

Gene Name

LY6G6D

UniProt

O95868

Expression Region

10-104aa

Organism

Homo sapiens (Human)

Target Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Tag

N-terminal 10xHis-B2M-JD-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

References & Citations

"Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAG7 Antibody - N-terminal region : Biotin (ARP66952_P050-Biotin)
ARP66952_P050-Biotin 100 µL

SPAG7 Antibody - N-terminal region : Biotin (ARP66952_P050-Biotin)

Sign In for Pricing
View Details
Sacs (NM_172809) Mouse Tagged Lenti ORF Clone
MR222057L3 10 µg

Sacs (NM_172809) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC36A4 (NM_152313) Human Untagged Clone
SC100884 10 µg

SLC36A4 (NM_152313) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Bcl2l14 qPCR Primer Pair
QM32746S 200 Tests

Mouse Bcl2l14 qPCR Primer Pair

Sign In for Pricing
View Details
GFRα-1 Polyclonal Antibody
ABP54514-01 30 µL

GFRα-1 Polyclonal Antibody

Sign In for Pricing
View Details
GFRα-1 Polyclonal Antibody
ABP54514-02 100 µL

GFRα-1 Polyclonal Antibody

Sign In for Pricing
View Details