Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Product Specifications

Product Name Alternative

Megakaryocyte-enhanced gene transcript 1 protein

Abbreviation

Recombinant Human LY6G6D protein, partial

Gene Name

LY6G6D

UniProt

O95868

Expression Region

10-104aa

Organism

Homo sapiens (Human)

Target Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Tag

N-terminal 10xHis-B2M-JD-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

References & Citations

"Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPGEF1 polyclonal antibody
BS72826-01 50 µL

RAPGEF1 polyclonal antibody

Sign In for Pricing
View Details
RAPGEF1 polyclonal antibody
BS72826-02 100 µL

RAPGEF1 polyclonal antibody

Sign In for Pricing
View Details
Human/Mouse LY6E Antibody (9B12)
orb3131733-01 10 mg

Human/Mouse LY6E Antibody (9B12)

Sign In for Pricing
View Details
Human/Mouse LY6E Antibody (9B12)
orb3131733-02 1 mg

Human/Mouse LY6E Antibody (9B12)

Sign In for Pricing
View Details
Human/Mouse LY6E Antibody (9B12)
orb3131733-03 5 mg

Human/Mouse LY6E Antibody (9B12)

Sign In for Pricing
View Details
Arl13b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4511003 1.0 µg DNA

Arl13b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details