Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymidine kinase 2, mitochondrial (TK2)

Product Specifications

Product Name Alternative

Mt-TK

Abbreviation

Recombinant Human TK2 protein

Gene Name

TK2

UniProt

O00142

Expression Region

34-265aa

Organism

Homo sapiens (Human)

Target Sequence

VQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Phosphorylates thymidine, deoxycytidine, and deoxyuridine in the mitochondrial matrix. In non-replicating cells, where cytosolic dNTP synthesis is down-regulated, mtDNA synthesis depends solely on TK2 and DGUOK. Widely used as target of antiviral and chemotherapeutic agents.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Phosphorylates thymidine, deoxycytidine, and deoxyuridine in the mitochondrial matrix. In non-replicating cells, where cytosolic dNTP synthesis is down-regulated, mtDNA synthesis depends solely on TK2 and DGUOK. Widely used as target of antiviral and chemotherapeutic agents.

Molecular Weight

32.5 kDa

References & Citations

"Human thymidine kinase 2: molecular cloning and characterisation of the enzyme activity with antiviral and cytostatic nucleoside substrates." Wang L., Munch-Petersen B., Herrstroem Sjoeberg A., Hellman U., Bergman T., Joernvall H., Eriksson S. FEBS Lett. 443:170-174 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPRIP Human Gene Knockout Kit (CRISPR)
KN211386LP 1 Kit

MPRIP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSD17B3 Mouse Monoclonal Antibody [Clone ID: OTI7F7]
CF811500 100 µg

HSD17B3 Mouse Monoclonal Antibody [Clone ID: OTI7F7]

Sign In for Pricing
View Details
c Kit (KIT) Rabbit Polyclonal Antibody
AP20497PU-N 100 µg

c Kit (KIT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS635480 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Rsrp1 Mouse Gene Knockout Kit (CRISPR)
KN515176 1 Kit

Rsrp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CBARA1 (MICU1) Human Gene Knockout Kit (CRISPR)
KN200921BN 1 Kit

CBARA1 (MICU1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details