Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epidermal growth factor-like protein 8 (Egfl8)

Product Specifications

Product Name Alternative

Ng3

Abbreviation

Recombinant Mouse Egfl8 protein

Gene Name

Egfl8

UniProt

Q6GUQ1

Expression Region

29-293aa

Organism

Mus musculus (Mouse)

Target Sequence

GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Interacting selectively and non-covalently with calcium ions (Ca2+) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49 kDa

References & Citations

"Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L. Genome Res. 13:2621-2636 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6816-5p antagomir
HY-RI02197A-01 5 nmol

Hsa-miR-6816-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-6816-5p antagomir
HY-RI02197A-02 20 nmol

Hsa-miR-6816-5p antagomir

Sign In for Pricing
View Details
Ruthenium (III) iodide, anhydrous, Ru 20.5% min
sc-272295 1 g

Ruthenium (III) iodide, anhydrous, Ru 20.5% min

Sign In for Pricing
View Details
IGF2BP2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62659R-BF555-01 20 µL

IGF2BP2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
IGF2BP2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62659R-BF555-02 100 µL

IGF2BP2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
LYPLAL1 siRNA Oligos set (Human)
27847171 3x 5 nmol

LYPLAL1 siRNA Oligos set (Human)

Sign In for Pricing
View Details