Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial

Product Specifications

Product Name Alternative

GlcB; MRA_1848Malate synthase G; EC 2.3.3.9

Abbreviation

Recombinant Mycobacterium tuberculosis glcB protein, partial

Gene Name

GlcB

UniProt

A5U3K4

Expression Region

136-263aa

Organism

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Target Sequence

GSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILE

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Molecular Weight

13.4 kDa

References & Citations

"Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv." Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L., Wang H., Wang S., Zhao G., Zhang Y. PLoS ONE 3:E2375-E2375 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY-3381916 25mg
A19483-25 25 mg

LY-3381916 25mg

Sign In for Pricing
View Details
3alpha-Hydroxy-5alpha-androstan-17-one sulfate with Pyridine
TRC-H247985-1G 1 g

3alpha-Hydroxy-5alpha-androstan-17-one sulfate with Pyridine

Sign In for Pricing
View Details
Lentiviral human OSBPL5 shRNA (UAS) - Lentiviral human OSBPL5 shRNA (UAS, iRFP) (25)
GTR15151022 1 Vial

Lentiviral human OSBPL5 shRNA (UAS) - Lentiviral human OSBPL5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 650)
MBS6229753-01 0.1 mL

RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 650)

Sign In for Pricing
View Details
RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 650)
MBS6229753-02 5x 0.1 mL

RUNX2 (Runt-Related Transcription Factor 2, AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1) (MaxLight 650)

Sign In for Pricing
View Details
Human TAFA3/FAM19A3 Alexa Fluor 405 Antibody (Clone 460904)
IC4677V-100UG 100 µg

Human TAFA3/FAM19A3 Alexa Fluor 405 Antibody (Clone 460904)

Sign In for Pricing
View Details