Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aquaporin-4 (Aqp4), partial

Product Specifications

Product Name Alternative

Mercurial-insensitive water channel

Abbreviation

Recombinant Mouse Aqp4 protein, partial

Gene Name

Aqp4

UniProt

P55088

Expression Region

253-323aa

Organism

Mus musculus (Mouse)

Target Sequence

CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Molecular Weight

10.9 kDa

References & Citations

"Role of aquaporin-4 in airspace-to-capillary water permeability in intact mouse lung measured by a novel gravimetric method." Song Y., Ma T., Matthay M.A., Verkman A.S. J. Gen. Physiol. 115:17-27 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody
abx005970-01 20 µL

CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody

Sign In for Pricing
View Details
CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody
abx005970-02 100 µL

CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody

Sign In for Pricing
View Details
CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody
abx005970-03 2x 100 µL

CCAAT/Enhancer Binding Protein Gamma (CEBPG) Antibody

Sign In for Pricing
View Details
Wdr46 (NM_020603) Mouse Tagged ORF Clone Lentiviral Particle
MR209503L3V 200 µL

Wdr46 (NM_020603) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cat Probable Cysteinyl-tRNA Synthetase, Mitochondrial (CARS2) ELISA Kit
MBS9929697 Inquire

Cat Probable Cysteinyl-tRNA Synthetase, Mitochondrial (CARS2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Nkx6-2 shRNA (UAS) - Lentiviral mouse Nkx6-2 shRNA (UAS, iRFP) plasmid
GTR15172192 1 Vial

Lentiviral mouse Nkx6-2 shRNA (UAS) - Lentiviral mouse Nkx6-2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details