Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Integrin beta-8 (ITGB8), partial

Product Specifications

Product Name Alternative

ITGB8Integrin beta-8

Abbreviation

Recombinant Rabbit ITGB8 protein, partial

Gene Name

ITGB8

UniProt

P26013

Expression Region

146-384aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Integrin alpha-V/beta-8 is a receptor for fibronectin.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Integrin alpha-V/beta-8 is a receptor for fibronectin.

Molecular Weight

31.9 kDa

References & Citations

"Cloning and expression of a divergent integrin subunit beta 8." Moyle M., Napier M.A., McLean J.W. J. Biol. Chem. 266:19650-19658 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (PE)
MBS6462826-01 0.2 mL

Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (PE)

Sign In for Pricing
View Details
Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (PE)
MBS6462826-02 5x 0.2 mL

Amphiregulin, CT (AREG, Colorectum Cell-derived Growth Factor, AREGB, AR, SDGF, CRDGF, MGC13647) (PE)

Sign In for Pricing
View Details
Bovine Peroxiredoxin-5, mitochondrial ELISA Kit
MBS2887263-01 48 Well

Bovine Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Peroxiredoxin-5, mitochondrial ELISA Kit
MBS2887263-02 96 Well

Bovine Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Peroxiredoxin-5, mitochondrial ELISA Kit
MBS2887263-03 5x 96 Well

Bovine Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Peroxiredoxin-5, mitochondrial ELISA Kit
MBS2887263-04 10x 96 Well

Bovine Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details