Recombinant Mouse Sulfotransferase 1A1 (Sult1a1)

MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk (By similarity) .

"PHR1 encodes an abundant, pleckstrin homology domain-containing integral membrane protein in the photoreceptor outer segments." Xu S., Ladak R., Swanson D.A., Soltyk A., Sun H., Ploder L., Vidgen D., Duncan A.M.V., Garami E., McInnes R.R., Valle D. J. Biol. Chem. 274:35676-35685 (1999)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.