Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A

Product Specifications

Product Name Alternative

Tendamistat

Abbreviation

Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A protein

UniProt

P01092

Expression Region

31-104aa

Organism

Streptomyces tendae

Target Sequence

DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1:1 complex with alpha-amylase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits mammalian alpha-amylases specifically but has no action on plant and microbial alpha-amylases. Forms a tight stoichiometric 1

Molecular Weight

28 kDa

References & Citations

"Tendamistat (HOE 467), a tight-binding alpha-amylase inhibitor from Streptomyces tendae 4158. Isolation, biochemical properties." Vertesy L., Oeding V., Bender R., Zepf K., Nesemann G. Eur. J. Biochem. 141:505-512 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL4 Antibody, Biotin conjugated
A19543-100UG 100 µg

DLL4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
XPO5 (Exportin 5, Exp5) (AP)
MBS6450232-01 0.1 mL

XPO5 (Exportin 5, Exp5) (AP)

Sign In for Pricing
View Details
XPO5 (Exportin 5, Exp5) (AP)
MBS6450232-02 5x 0.1 mL

XPO5 (Exportin 5, Exp5) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Rpp25l shRNA (UAS) - Lentiviral mouse Rpp25l shRNA (UAS, GFP) (100)
GTR15282021 1 Vial

Lentiviral mouse Rpp25l shRNA (UAS) - Lentiviral mouse Rpp25l shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Porcine beta anti-galactan proteins IgG (beta-AGP IgG) ELISA Kit
MBS267112-01 48 Well

Porcine beta anti-galactan proteins IgG (beta-AGP IgG) ELISA Kit

Sign In for Pricing
View Details
Porcine beta anti-galactan proteins IgG (beta-AGP IgG) ELISA Kit
MBS267112-02 96 Well

Porcine beta anti-galactan proteins IgG (beta-AGP IgG) ELISA Kit

Sign In for Pricing
View Details