Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Penaeus sp. Sarcoplasmic calcium-binding protein, alpha-B and -A chains

Product Specifications

Product Name Alternative

; Sarcoplasmic calcium-binding protein; alpha-B and -A chains; SCP alpha chain

Abbreviation

Recombinant Penaeus sp. SCP alpha chain protein

UniProt

P02636

Expression Region

1-192aa

Organism

Penaeus sp. (Penoeid shrimp)

Target Sequence

AYSWDNRVKYVVRYMYDIDDDGFLDKNDFECLAVRNTLIEGRGEFSAADYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKMAVQKHCQGKKYSEFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYDKLTTEDDRKAGGLTLERYQDLYAQFISNPNESCSACFLFGPLKVVQ

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Like parvalbumins, SCP's seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Like parvalbumins, SCP's seem to be more abundant in fast contracting muscles, but no functional relationship can be established from this distribution.

Molecular Weight

42 kDa

References & Citations

"Amino acid sequence of alpha chain of sarcoplasmic calcium binding protein obtained from shrimp tail muscle." Takagi T., Konishi K. J. Biochem. 95:1603-1615 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3226), CF405S conjugate, 0.1mg/mL
BNC043226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Potassium Biphthalate
TRC-P698758-1G 1 g

Potassium Biphthalate

Sign In for Pricing
View Details
SDHA Rabbit Polyclonal Antibody
TA361186 100 µL

SDHA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DEFB132 (NM_207469) Human Over-expression Lysate
LY404044 100 µg

DEFB132 (NM_207469) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561416 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Atractyligenin
TRC-A794525-5MG 5 mg

Atractyligenin

Sign In for Pricing
View Details