Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial

Product Specifications

Product Name Alternative

Ly-6G.1

Abbreviation

Recombinant Mouse Ly6g protein, partial

Gene Name

Ly6g

UniProt

P35461

Expression Region

27-119aa

Organism

Mus musculus (Mouse)

Target Sequence

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11.9 kDa

References & Citations

"The monoclonal antibody TER-119 recognizes a molecule associated with glycophorin A and specifically marks the late stages of murine erythroid lineage." Kina T., Ikuta K., Takayama E., Wada K., Majumdar A.S., Weissman I.L., Katsura Y. Br. J. Haematol. 109:280-287 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit
E-CL-H1196-01 24 Tests

Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit

Sign In for Pricing
View Details
Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit
E-CL-H1196-02 48 Tests

Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit

Sign In for Pricing
View Details
Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit
E-CL-H1196-03 96 Tests

Human NE/ELA2 (Elastase 2, Neutrophil) CLIA Kit

Sign In for Pricing
View Details
PHF2P1 Human qPCR Primer Pair (NR_002801)
HP220168 200 Reactions

PHF2P1 Human qPCR Primer Pair (NR_002801)

Sign In for Pricing
View Details
Human ARL6IP6 activation kit by CRISPRa
GA115780 1 Kit

Human ARL6IP6 activation kit by CRISPRa

Sign In for Pricing
View Details
SHP2 (PTPN11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA501758AM 100 µL

SHP2 (PTPN11) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

Sign In for Pricing
View Details