Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor

Abbreviation

Recombinant Mouse Il18 protein

Gene Name

Il18

UniProt

P70380

Expression Region

1-192aa

Organism

Mus musculus (Mouse)

Target Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Molecular Weight

24.6 kDa

References & Citations

"Active stage of autoimmune diabetes is associated with the expression of a novel cytokine, IGIF, which is located near Idd2." Rothe H., Jenkins N.A., Copeland N.G., Kolb H. J. Clin. Invest. 99:469-474 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp7 Protein Vector (Mouse) (pPB-C-His)
PV250062 500 ng

Zfp7 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
PKLR Antibody
orb2683619-01 50 µL

PKLR Antibody

Sign In for Pricing
View Details
PKLR Antibody
orb2683619-02 100 µL

PKLR Antibody

Sign In for Pricing
View Details
PKLR Antibody
orb2683619-03 200 µL

PKLR Antibody

Sign In for Pricing
View Details
Lentiviral mouse Asb10 shRNA (UAS) - Lentiviral mouseAsb10 shRNA (UAS, GFP) (25)
GTR15104132 1 Vial

Lentiviral mouse Asb10 shRNA (UAS) - Lentiviral mouseAsb10 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Human IgE
FA-2104-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human IgE

Sign In for Pricing
View Details