Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial

Product Specifications

Product Name Alternative

HN; Hemagglutinin-neuraminidase; EC 3.2.1.18

Abbreviation

Recombinant Newcastle disease virus Hemagglutinin-neuraminidase protein, partial

Gene Name

HN

UniProt

P35741

Expression Region

115-473aa

Organism

Newcastle disease virus (strain Her/33) (NDV)

Target Sequence

NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion (By similarity) .

Molecular Weight

44.2 kDa

References & Citations

"Newcastle disease virus evolution. I. Multiple lineages defined by sequence variability of the hemagglutinin-neuraminidase gene." Sakaguchi T., Toyoda T., Gotoh B., Inocencio N.M., Kuma K., Miyata T., Nagai Y. Virology 169:260-272 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans F34H10.4 Polyclonal Antibody
MBS7187385 Inquire

Rabbit anti-Caenorhabditis elegans F34H10.4 Polyclonal Antibody

Sign In for Pricing
View Details
Purified anti-human CD354 (TREM-1)
GT09510 100 µg

Purified anti-human CD354 (TREM-1)

Sign In for Pricing
View Details
Cd79a (BC027633) Mouse Tagged Lenti ORF Clone
MR202501L4 10 µg

Cd79a (BC027633) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit
MBS2610669-01 48 Well

Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit
MBS2610669-02 96 Well

Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit
MBS2610669-03 5x 96 Well

Mouse Tyrosine kinase with Ig and EGF homology domains 2 (Tie-2) ELISA Kit

Sign In for Pricing
View Details