Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus X Outer capsid protein VP4, partial

Product Specifications

Product Name Alternative

Hemagglutinin

Abbreviation

Recombinant Rotavirus X Outer capsid protein VP4 protein, partial

UniProt

A9Q1L0

Expression Region

1-249aa

Organism

Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )

Target Sequence

MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors (By similarity) .

Molecular Weight

30.8 kDa

References & Citations

"Whole genomic characterization of a human rotavirus strain B219 belonging to a novel group of the genus Rotavirus." Nagashima S., Kobayashi N., Ishino M., Alam M.M., Ahmed M.U., Paul S.K., Ganesh B., Chawla-Sarkar M., Krishnan T., Naik T.N., Wang Y.-H. J. Med. Virol. 80:2023-2033 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 700 anti-mouse CD45.2
E16FMI045.2-025U 25 µg

Alexa Fluor® 700 anti-mouse CD45.2

Sign In for Pricing
View Details
3- ((2,3-dichlorophenoxy) methyl) -4-phenyl-1,2,4-triazoline-5-thione
RGB71722 250 mg

3- ((2,3-dichlorophenoxy) methyl) -4-phenyl-1,2,4-triazoline-5-thione

Sign In for Pricing
View Details
KIAA1841 3'UTR Lenti-reporter-Luc Vector
25642081 1.0 µg

KIAA1841 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-AACT Mouse mAb
GB14008-50 50 μL

Anti-AACT Mouse mAb

Sign In for Pricing
View Details
MYC Antibody
A76216-50UL 50 μL

MYC Antibody

Sign In for Pricing
View Details
IKA A11.6 double betaer for use with A11.4 chamber. Suitable for materials upto 3 Mohs hardness
MIL2148 1 Each

IKA A11.6 double betaer for use with A11.4 chamber. Suitable for materials upto 3 Mohs hardness

Sign In for Pricing
View Details