Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB)

Product Specifications

Product Name Alternative

DinB; CPS_1040DNA polymerase IV; Pol IV; EC 2.7.7.7

Abbreviation

Recombinant Colwellia psychrerythraea dinB protein

Gene Name

DinB

UniProt

Q487H6

Expression Region

1-352aa

Organism

Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Target Sequence

MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.

Molecular Weight

43.3 kDa

References & Citations

"The psychrophilic lifestyle as revealed by the genome sequence of Colwellia psychrerythraea 34H through genomic and proteomic analyses." Methe B.A., Nelson K.E., Deming J.W., Momen B., Melamud E., Zhang X., Moult J., Madupu R., Nelson W.C., Dodson R.J., Brinkac L.M., Daugherty S.C., Durkin A.S., DeBoy R.T., Kolonay J.F., Sullivan S.A., Zhou L., Davidsen T.M. Fraser C.M. Proc. Natl. Acad. Sci. U.S.A. 102:10913-10918 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDPK1 Blocking Peptide
33R-4000 100 ug

PDPK1 Blocking Peptide

Ask
View Details
TIF1 gamma (TRIM33) Mouse Monoclonal Antibody [Clone ID: OTI9D4]
TA500119 100 µL

TIF1 gamma (TRIM33) Mouse Monoclonal Antibody [Clone ID: OTI9D4]

Ask
View Details
Human Echinoderm Microtubule Associated Protein Like 4 (EML4) ELISA Kit
abx387140 96 Tests

Human Echinoderm Microtubule Associated Protein Like 4 (EML4) ELISA Kit

Ask
View Details
ACAT1 (Very Long-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, VLCAD, Vlcad) discontinued
A0219-90M 100 µg

ACAT1 (Very Long-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, VLCAD, Vlcad) discontinued

Ask
View Details