Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Acyl carrier protein (acpP)

Product Specifications

Product Name Alternative

Cytosolic-activating factor

Abbreviation

Recombinant E.coli acpP protein

Gene Name

AcpP

UniProt

P0A6A8

Expression Region

1-78aa

Organism

Escherichia coli (strain K12)

Target Sequence

MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Carrier of the growing fatty acid chain in fatty acid biosynthesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.6 kDa

References & Citations

"Altered molecular form of acyl carrier protein associated with beta-ketoacyl-acyl carrier protein synthase II (fabF) mutants." Jackowski S., Rock C.O. J. Bacteriol. 169:1469-1473 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Endostatin (ES) ELISA Kit
MBS266186-01 48 Well

Mouse Endostatin (ES) ELISA Kit

Sign In for Pricing
View Details
Mouse Endostatin (ES) ELISA Kit
MBS266186-02 96 Well

Mouse Endostatin (ES) ELISA Kit

Sign In for Pricing
View Details
Mouse Endostatin (ES) ELISA Kit
MBS266186-03 5x 96 Well

Mouse Endostatin (ES) ELISA Kit

Sign In for Pricing
View Details
Mouse Endostatin (ES) ELISA Kit
MBS266186-04 10x 96 Well

Mouse Endostatin (ES) ELISA Kit

Sign In for Pricing
View Details
Goat CytoKeratin 17 ELISA Kit
MBS740948-01 48 Well

Goat CytoKeratin 17 ELISA Kit

Sign In for Pricing
View Details
Goat CytoKeratin 17 ELISA Kit
MBS740948-02 96 Well

Goat CytoKeratin 17 ELISA Kit

Sign In for Pricing
View Details