Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collectrin (Cltrn), partial

Product Specifications

Product Name Alternative

Transmembrane protein 27

Abbreviation

Recombinant Mouse Cltrn protein, partial

Gene Name

Cltrn

UniProt

Q9ESG4

Expression Region

15-141aa

Organism

Mus musculus (Mouse)

Target Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Regulator of SNARE complex function. Stimulator of beta cell replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulator of SNARE complex function. Stimulator of beta cell replication.

Molecular Weight

34.5 kDa

References & Citations

"Collectrin, a collecting duct-specific transmembrane glycoprotein, is a novel homolog of ACE2 and is developmentally regulated in embryonic kidneys." Zhang H., Wada J., Hida K., Tsuchiyama Y., Hiragushi K., Shikata K., Wang H., Lin S., Kanwar Y.S., Makino H. J. Biol. Chem. 276:17132-17139 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBC Mouse Monoclonal Antibody (PE-Cy5)
orb2867122 100 µL

RBC Mouse Monoclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
CD96 Protein Vector (Mouse) (pPB-N-His)
PV163667 500 ng

CD96 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ST6GAL2, CT (ST6GAL2, KIAA1877, SIAT2, Beta-galactoside alpha-2,6-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, ST6Gal II, Sialyltransferase 2) (MaxLight 750) discontinued
042352-ML750 100 µL

ST6GAL2, CT (ST6GAL2, KIAA1877, SIAT2, Beta-galactoside alpha-2,6-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, ST6Gal II, Sialyltransferase 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SYJ2B Antibody
MBS9520904-01 0.04 mL

SYJ2B Antibody

Sign In for Pricing
View Details
SYJ2B Antibody
MBS9520904-02 0.1 mL

SYJ2B Antibody

Sign In for Pricing
View Details
SYJ2B Antibody
MBS9520904-03 0.2 mL

SYJ2B Antibody

Sign In for Pricing
View Details