Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collectrin (Cltrn), partial

Product Specifications

Product Name Alternative

Transmembrane protein 27

Abbreviation

Recombinant Mouse Cltrn protein, partial

Gene Name

Cltrn

UniProt

Q9ESG4

Expression Region

15-141aa

Organism

Mus musculus (Mouse)

Target Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Regulator of SNARE complex function. Stimulator of beta cell replication.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulator of SNARE complex function. Stimulator of beta cell replication.

Molecular Weight

34.5 kDa

References & Citations

"Collectrin, a collecting duct-specific transmembrane glycoprotein, is a novel homolog of ACE2 and is developmentally regulated in embryonic kidneys." Zhang H., Wada J., Hida K., Tsuchiyama Y., Hiragushi K., Shikata K., Wang H., Lin S., Kanwar Y.S., Makino H. J. Biol. Chem. 276:17132-17139 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCDHA8 Antibody Picoband® Fluoro550 Conjugated
A15533-Fluoro550 100 µg/Vial

Anti-PCDHA8 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
BVES siRNA (Human)
orb1860627-01 15 nmol

BVES siRNA (Human)

Sign In for Pricing
View Details
BVES siRNA (Human)
orb1860627-02 30 nmol

BVES siRNA (Human)

Sign In for Pricing
View Details
Human Neutrophil CAP 18
117246 100 µg

Human Neutrophil CAP 18

Sign In for Pricing
View Details
Tcf7l1 3'UTR Luciferase Stable Cell Line
TU120278 1.0 mL

Tcf7l1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MCP-3 Polyclonal Antibody
RA27098-01 50 µL

MCP-3 Polyclonal Antibody

Sign In for Pricing
View Details