Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx2

Product Specifications

Product Name Alternative

ITRL-2

Abbreviation

Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx2 protein

UniProt

Q43691

Expression Region

25-121aa

Organism

Triticum aestivum (Wheat)

Target Sequence

FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLLQDMSRCKKLTREFIAGIVGRE

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.5 kDa

References & Citations

"Sharp divergence between wheat and barley at loci encoding novel members of the trypsin/alpha-amylase inhibitors family." Sanchez de la Hoz P., Castagnaro A., Carbonero P. Plant Mol. Biol. 26:1231-1236 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku80 (XRCC5) (462-475) goat polyclonal antibody, Aff - Purified
AP08881PU-N 50 µg

Ku80 (XRCC5) (462-475) goat polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
ATPIF1 Polyclonal Antibody
RD83177A-01 60μL

ATPIF1 Polyclonal Antibody

Sign In for Pricing
View Details
ATPIF1 Polyclonal Antibody
RD83177A-02 120μL

ATPIF1 Polyclonal Antibody

Sign In for Pricing
View Details
ATPIF1 Polyclonal Antibody
RD83177A-03 200μL

ATPIF1 Polyclonal Antibody

Sign In for Pricing
View Details
Thalidomide-5-O-C4-NH2 hydrochloride
MF-0156446-01 5 mg

Thalidomide-5-O-C4-NH2 hydrochloride

Sign In for Pricing
View Details
Thalidomide-5-O-C4-NH2 hydrochloride
MF-0156446-02 50 mg

Thalidomide-5-O-C4-NH2 hydrochloride

Sign In for Pricing
View Details