Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coturnix delegorguei Ovomucoid, partial

Product Specifications

Product Name Alternative

Ovomucoid; Fragment

Abbreviation

Recombinant Coturnix delegorguei Ovomucoid protein, partial

UniProt

P05600

Expression Region

1-52aa

Organism

Coturnix delegorguei (Harlequin quail)

Target Sequence

SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

References & Citations

"Ovomucoid third domains from 100 avian species: isolation, sequences, and hypervariability of enzyme-inhibitor contact residues." Laskowski M. Jr., Kato I., Ardelt W., Cook J., Denton A., Empie M.W., Kohr W.J., Park S.J., Parks K., Schatzley B.L., Schoenberger O.L., Tashiro M., Vichot G., Whatley H.E., Wieczorek A., Wieczorek M. Biochemistry 26:202-221 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A1 antibody - N-terminal region (ARP33801_P050)
ARP33801_P050 100 µL

SLC4A1 antibody - N-terminal region (ARP33801_P050)

Sign In for Pricing
View Details
Human MTCP1 activation kit by CRISPRa
GA103010 1 Kit

Human MTCP1 activation kit by CRISPRa

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33)
247050 100 µg

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33)

Sign In for Pricing
View Details
Anti-Keratin K2, guinea pig pab
GP-CK2E 100 µL

Anti-Keratin K2, guinea pig pab

Sign In for Pricing
View Details
Recombinant Human EpCAM Protein (His Tag)
MBS2569006-01 0.02 mg

Recombinant Human EpCAM Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EpCAM Protein (His Tag)
MBS2569006-02 0.1 mg

Recombinant Human EpCAM Protein (His Tag)

Sign In for Pricing
View Details