Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coturnix delegorguei Ovomucoid, partial

Product Specifications

Product Name Alternative

Ovomucoid; Fragment

Abbreviation

Recombinant Coturnix delegorguei Ovomucoid protein, partial

UniProt

P05600

Expression Region

1-52aa

Organism

Coturnix delegorguei (Harlequin quail)

Target Sequence

SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

References & Citations

"Ovomucoid third domains from 100 avian species: isolation, sequences, and hypervariability of enzyme-inhibitor contact residues." Laskowski M. Jr., Kato I., Ardelt W., Cook J., Denton A., Empie M.W., Kohr W.J., Park S.J., Parks K., Schatzley B.L., Schoenberger O.L., Tashiro M., Vichot G., Whatley H.E., Wieczorek A., Wieczorek M. Biochemistry 26:202-221 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLH1 (NM_000249) Human Mutant ORF Clone
RC401515 10 µg

mLH1 (NM_000249) Human Mutant ORF Clone

Sign In for Pricing
View Details
C6orf201 Human shRNA Lentiviral Particle (Locus ID 404220)
TL305800V 500 µL Each

C6orf201 Human shRNA Lentiviral Particle (Locus ID 404220)

Sign In for Pricing
View Details
DHBP dibromide
orb1299906-01 1 ml x 10 mM (in DMSO)

DHBP dibromide

Sign In for Pricing
View Details
DHBP dibromide
orb1299906-02 200 mg

DHBP dibromide

Sign In for Pricing
View Details
SPSB3 Adenovirus (Mouse)
45410055 1.0 mL

SPSB3 Adenovirus (Mouse)

Sign In for Pricing
View Details
MAPK6 (Mitogen-Activated Protein Kinase 6, DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK)
248508 50 µg

MAPK6 (Mitogen-Activated Protein Kinase 6, DKFZp686F03189, ERK3, HsT17250, PRKM6, p97MAPK)

Sign In for Pricing
View Details