Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biglycan (BGN)

Product Specifications

Product Name Alternative

Bone/cartilage proteoglycan I PG-S1

Abbreviation

Recombinant Human BGN protein

Gene Name

BGN

UniProt

P21810

Expression Region

38-368aa

Organism

Homo sapiens (Human)

Target Sequence

DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May be involved in collagen fiber assembly.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in collagen fiber assembly.

Molecular Weight

57.2 kDa

References & Citations

"Deduced protein sequence of bone small proteoglycan I (biglycan) shows homology with proteoglycan II (decorin) and several nonconnective tissue proteins in a variety of species." Fisher L.W., Termine J.D., Young M.F. J. Biol. Chem. 264:4571-4576 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-6905-3p miRNA Mimic
MBS8301912-01 5 nmol

mmu-miR-6905-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-6905-3p miRNA Mimic
MBS8301912-02 10 nmol

mmu-miR-6905-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-6905-3p miRNA Mimic
MBS8301912-03 5x 10 nmol

mmu-miR-6905-3p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2)
orb2927409-01 20 µg

Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2)

Sign In for Pricing
View Details
Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2)
orb2927409-02 100 µg

Recombinant Candida glabrata Golgi to ER traffic protein 2 (GET2)

Sign In for Pricing
View Details
Rabbit Anti ESRRG Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)
IRBAMLESRRGAP996200UL 1 Each

Rabbit Anti ESRRG Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA)

Sign In for Pricing
View Details