Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Leukocidin-F subunit (lukF)

Product Specifications

Product Name Alternative

Gamma-hemolysin, H-gamma-I subunit

Abbreviation

Recombinant Staphylococcus aureus lukF protein

Gene Name

LukF

UniProt

P31715

Expression Region

26-323aa

Organism

Staphylococcus aureus

Target Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Leukocidin causes cytotoxic changes in polymorphonuclear leukocytes. Gamma-hemolysin causes hemolysis in red blood cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Leukocidin causes cytotoxic changes in polymorphonuclear leukocytes. Gamma-hemolysin causes hemolysis in red blood cells.

Molecular Weight

54 kDa

References & Citations

"The two Staphylococcal bi-component toxins, leukocidin and gamma-hemolysin, share one component in common." Kamio Y., Rahman A., Nariya H., Ozawa T., Izaki K. FEBS Lett. 321:15-18 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Septin6 Plasmid
PVT44275 2 µg

pCMV-SPORT6-Septin6 Plasmid

Sign In for Pricing
View Details
Angpt2 (NM_007426) Mouse Untagged Clone
MC204588 10 µg

Angpt2 (NM_007426) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Deleted In Liver Cancer 1 (DLC1) ELISA Kit
AE47171MO-01 48 Tests

Mouse Deleted In Liver Cancer 1 (DLC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Deleted In Liver Cancer 1 (DLC1) ELISA Kit
AE47171MO-02 96 Tests

Mouse Deleted In Liver Cancer 1 (DLC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant African horse sickness virus 6 Outer capsid protein VP5 (S6), partial
MBS1013901 Inquire

Recombinant African horse sickness virus 6 Outer capsid protein VP5 (S6), partial

Sign In for Pricing
View Details
ASNSD1 Protein Vector (Human) (pPM-N-D-C-HA)
PV324392 500 ng

ASNSD1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details