Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial

Product Specifications

Product Name Alternative

358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2

Abbreviation

Recombinant Human RANBP2 protein, partial

Gene Name

RANBP2

UniProt

P49792

Expression Region

2601-2802aa

Organism

Homo sapiens (Human)

Target Sequence

PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS

Tag

N-terminal 6xHis-B2M-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin) -mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro) . May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin) -mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro) . May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle

Molecular Weight

36.8 kDa

References & Citations

"Nup358, a cytoplasmically exposed nucleoporin with peptide repeats, Ran-GTP binding sites, zinc fingers, a cyclophilin A homologous domain, and a leucine-rich region." Wu J., Matunis M.J., Kraemer D., Blobel G., Coutavas E. J. Biol. Chem. 270:14209-14213 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human S100 Calcium Binding Protein A15 (S100A15) ELISA Kit
201-12-2184 96 Tests

Human S100 Calcium Binding Protein A15 (S100A15) ELISA Kit

Ask
View Details
Mouse Monoclonal Nrf1 Antibody (NRF1/2608) [Alexa Fluor 532]
NBP3-08751AF532 100 µL

Mouse Monoclonal Nrf1 Antibody (NRF1/2608) [Alexa Fluor 532]

Ask
View Details
Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)
MBS1170776-01 0.02 mg (E-Coli)

Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)

Ask
View Details
Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)
MBS1170776-02 0.02 mg (Yeast)

Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)

Ask
View Details
Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)
MBS1170776-03 0.1 mg (E-Coli)

Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)

Ask
View Details
Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)
MBS1170776-04 0.1 mg (Yeast)

Recombinant Arcobacter butzleri Bifunctional protein FolD (folD)

Ask
View Details