Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-B (CSTB)

Product Specifications

Product Name Alternative

CPI-B Liver thiol proteinase inhibitor Stefin-B

Abbreviation

Recombinant Human CSTB protein

Gene Name

CSTB

UniProt

P04080

Expression Region

1-98aa

Organism

Homo sapiens (Human)

Target Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Molecular Weight

27.1 kDa

References & Citations

"Amino acid sequence of the intracellular cysteine proteinase inhibitor cystatin B from human liver." Ritonja A., Machleidt W., Barrett A.J. Biochem. Biophys. Res. Commun. 131:1187-1192 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MELK Antibody
R34627-100UG 100 µg

MELK Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Parvalbumin Antibody [DyLight 550]
NBP2-97031R 0.1 mL

Rabbit Polyclonal Parvalbumin Antibody [DyLight 550]

Sign In for Pricing
View Details
PLEKHG5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV662601 1.0 µg DNA

PLEKHG5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD86
GT08329 25 Tests

Alexa Fluor® 647 anti-human CD86

Sign In for Pricing
View Details
Human Fatty Acid Transport Protein 5 (FATP5) ELISA Kit
CK-bio-11444-01 48 Tests

Human Fatty Acid Transport Protein 5 (FATP5) ELISA Kit

Sign In for Pricing
View Details
Human Fatty Acid Transport Protein 5 (FATP5) ELISA Kit
CK-bio-11444-02 96 Tests

Human Fatty Acid Transport Protein 5 (FATP5) ELISA Kit

Sign In for Pricing
View Details