Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Metapyrocatechase (xylE)

Product Specifications

Product Name Alternative

CatO2ase Catechol 2,3-dioxygenase

Abbreviation

Recombinant Pseudomonas putida xylE protein

Gene Name

XylE

UniProt

P06622

Expression Region

1-307aa

Organism

Pseudomonas putida (Arthrobacter siderocapsulatus)

Target Sequence

MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

55.2 kDa

References & Citations

"Chromogenic identification of genetic regulatory signals in Bacillus subtilis based on expression of a cloned Pseudomonas gene." Zukowski M.M., Gaffney D.F., Speck D., Kauffmann M., Findeli A., Wisecup A., Lecocq J.-P. Proc. Natl. Acad. Sci. U.S.A. 80:1101-1105 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-01 0.05 mg (E-Coli)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-02 0.05 mg (Baculovirus)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-03 0.2 mg (E-Coli)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-04 0.2 mg (Yeast)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-05 0.5 mg (E-Coli)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Glycerol kinase (glpK), partial
MBS1141564-06 0.05 mg (Mammalian-Cell)

Recombinant Coxiella burnetii Glycerol kinase (glpK), partial

Sign In for Pricing
View Details