Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-245 heavy chain (CYBB), partial

Product Specifications

Product Name Alternative

CGD91-phox Cytochrome b (558) subunit beta

Abbreviation

Recombinant Human CYBB protein, partial

Gene Name

CYBB

UniProt

P04839

Expression Region

283-570aa

Organism

Homo sapiens (Human)

Target Sequence

ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H (+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.

Molecular Weight

35.2 kDa

References & Citations

"The glycoprotein encoded by the X-linked chronic granulomatous disease locus is a component of the neutrophil cytochrome b complex." Dinauer M.C., Orkin S.H., Brown R., Jesaitis A.J., Parkos C.A. Nature 327:717-720 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nori® Canine PLA2G2A ELISA Kit
GR115171 96 Well

Nori® Canine PLA2G2A ELISA Kit

Ask
View Details
Lentiviral mouse Aldh1a1 shRNA (UAS) - Lentiviral mouse Aldh1a1 shRNA (UAS, RFP) (25)
GTR15269951 1 Vial

Lentiviral mouse Aldh1a1 shRNA (UAS) - Lentiviral mouse Aldh1a1 shRNA (UAS, RFP) (25)

Ask
View Details
Rabbit Polyclonal EXOC5 Antibody [DyLight 550]
NBP2-99472R 0.1 mL

Rabbit Polyclonal EXOC5 Antibody [DyLight 550]

Ask
View Details
Lentiviral human TMEM128 sgRNA gene knockout kit - Lentiviral human TMEM128 sgRNA gene knockout kit (100)
GTR15375637 1 Vial

Lentiviral human TMEM128 sgRNA gene knockout kit - Lentiviral human TMEM128 sgRNA gene knockout kit (100)

Ask
View Details
Akt1 (RAC-alpha Serine/Threonine-protein Kinase, Protein Kinase B, PKB, Protein Kinase B alpha, PKB alpha, Proto-oncogene c-Akt, RAC-PK-alpha, PKB, RAC)
A1125-13H 100 µg

Akt1 (RAC-alpha Serine/Threonine-protein Kinase, Protein Kinase B, PKB, Protein Kinase B alpha, PKB alpha, Proto-oncogene c-Akt, RAC-PK-alpha, PKB, RAC)

Ask
View Details
Ghrh Mouse siRNA Oligo Duplex (Locus ID 14601)
SR401172 1 Kit

Ghrh Mouse siRNA Oligo Duplex (Locus ID 14601)

Ask
View Details