Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein-3 (MT3)

Product Specifications

Product Name Alternative

GIFB

Abbreviation

Recombinant Human MT3 protein

Gene Name

MT3

UniProt

P25713

Expression Region

1-68aa

Organism

Homo sapiens (Human)

Target Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Molecular Weight

33.9 kDa

References & Citations

"Modulation of metallothionein-III mRNA content and growth rate of rat C6-glial cells by transfection with human 5-HT1D receptor genes." Amoureux M.C., Wurch T., Pauwels P.J. Biochem. Biophys. Res. Commun. 214:639-645 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NSDHL Antibody
RC-5835-01 50 μL

Recombinant NSDHL Antibody

Sign In for Pricing
View Details
Recombinant NSDHL Antibody
RC-5835-02 100 µL

Recombinant NSDHL Antibody

Sign In for Pricing
View Details
Recombinant NSDHL Antibody
RC-5835-03 1 mL

Recombinant NSDHL Antibody

Sign In for Pricing
View Details
Human ZNF789 activation kit by CRISPRa
GA117269 1 Kit

Human ZNF789 activation kit by CRISPRa

Sign In for Pricing
View Details
VEGFA Human Gene Knockout Kit (CRISPR)
KN217312LP 1 Kit

VEGFA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAF5 Polyclonal Antibody
E-AB-67472-01 60 µL

TRAF5 Polyclonal Antibody

Sign In for Pricing
View Details