Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis delta virus genotype I Large delta antigen

Product Specifications

Product Name Alternative

P27

Abbreviation

Recombinant Hepatitis delta virus genotype I Large delta antigen protein

UniProt

P0C6L6

Expression Region

1-211aa

Organism

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Target Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication (By similarity) .

Molecular Weight

27.7 kDa

References & Citations

"Structure, sequence and expression of the hepatitis delta (delta) viral genome." Wang K.S., Choo Q.L., Weiner A.J., Ou J.H., Najarian R.C., Thayer R.M., Mullenbach G.T., Denniston K.J., Gerin J.L., Houghton M. Nature 323:508-514 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details
Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-02 0.02 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details
Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details
Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-04 0.1 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details
Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details
Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)
MBS1474746-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O6:K15:H31 HTH-type transcriptional regulator sgrR (sgrR)

Ask
View Details