Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gamma-crystallin B (Crygb)

Product Specifications

Product Name Alternative

Gamma-B-crystallin Gamma-crystallin 1-2

Abbreviation

Recombinant Rat Crygb protein

Gene Name

Crygb

UniProt

P10066

Expression Region

2-175aa

Organism

Rattus norvegicus (Rat)

Target Sequence

GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Crystallins are the dominant structural components of the vertebrate eye lens.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Crystallins are the dominant structural components of the vertebrate eye lens.

Molecular Weight

23 kDa

References & Citations

"Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region." den Dunnen J.T., van Neck J.W., Cremers F.P.M., Lubsen N.H., Schoenmakers J.G.G. Gene 78:201-213 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS18 (Regulator of G-Protein Signaling 18, Regulator of G-Protein Signalling 18) discontinued
R1996-36D 100 µg

RGS18 (Regulator of G-Protein Signaling 18, Regulator of G-Protein Signalling 18) discontinued

Sign In for Pricing
View Details
Homophthalic acid
sc-255204 25 g

Homophthalic acid

Sign In for Pricing
View Details
Gba2 ORF Vector (Mouse) (pORF)
21343014 1.0 µg DNA

Gba2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GNRH2 (Progonadoliberin-2, Gonadotropin Releasing Hormone 2)
482013 100 µL

GNRH2 (Progonadoliberin-2, Gonadotropin Releasing Hormone 2)

Sign In for Pricing
View Details
APOC4 Polyclonal Antibody
BT-AP14257-01 20 µL

APOC4 Polyclonal Antibody

Sign In for Pricing
View Details
APOC4 Polyclonal Antibody
BT-AP14257-02 50 µL

APOC4 Polyclonal Antibody

Sign In for Pricing
View Details